PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_8116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 274aa    MW: 29880.5 Da    PI: 7.9899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_8116.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-54311591128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++  +
  MLOC_8116.1  31 LPPGFRFHPTDEELVVHYLKKKAAKVPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASgcG 127
                  79****************************.89***************988899****************************************9999 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  MLOC_8116.1 128 REKVGVKKALVFYRGKPPKGLKTNWIMHEYRL 159
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6428196IPR003441NAC domain
PROSITE profilePS5100561.61931196IPR003441NAC domain
PfamPF023654.2E-2832159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MRSMGSSDSS SGSAPPRHQP PPPQQGSAPE LPPGFRFHPT DEELVVHYLK KKAAKVPLPV  60
TIIAEVDLYK FDPWELPEKA TFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP  120
ILASGCGREK VGVKKALVFY RGKPPKGLKT NWIMHEYRLT DASSSAATSR PPPVTGGSRA  180
ASLRLDDWVL CRIYKKINKA AAADQQRSME CEDSVEDAVT AYPPYATACM TGEGAHGSNY  240
ASLLHHQDSH EDNFLDGLLT AEDAGLSAGA TSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-743120017169NO APICAL MERISTEM PROTEIN
1ut4_B2e-743120017169NO APICAL MERISTEM PROTEIN
1ut7_A2e-743120017169NO APICAL MERISTEM PROTEIN
1ut7_B2e-743120017169NO APICAL MERISTEM PROTEIN
3swm_A2e-743120020172NAC domain-containing protein 19
3swm_B2e-743120020172NAC domain-containing protein 19
3swm_C2e-743120020172NAC domain-containing protein 19
3swm_D2e-743120020172NAC domain-containing protein 19
3swp_A2e-743120020172NAC domain-containing protein 19
3swp_B2e-743120020172NAC domain-containing protein 19
3swp_C2e-743120020172NAC domain-containing protein 19
3swp_D2e-743120020172NAC domain-containing protein 19
4dul_A2e-743120017169NAC domain-containing protein 19
4dul_B2e-743120017169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3735150.0AK373515.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3033K10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562891.11e-165PREDICTED: NAC transcription factor NAM-B2-like
SwissprotA0SPJ90.0NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLF2EBJ00.0F2EBJ0_HORVD; Predicted protein
TrEMBLM0ZBU70.0M0ZBU7_HORVD; Uncharacterized protein
STRINGMLOC_8116.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.12e-96NAC domain containing protein 2